DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Crispld2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:243 Identity:51/243 - (20%)
Similarity:92/243 - (37%) Gaps:75/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 REARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSG 117
            |..|.||:|::.:..::|  |..|.||       :.||..|..:.||.||.:.|...|.||    
Mouse    46 RVRRAIPMSDRQEILMLH--NKLRGQV-------YPPASNMEHMTWDEELERSAAAWAHRC---- 97

  Fly   118 DGCRNTRRFKHVGQLTGH----VIFSAGKHSDLELLRHK-----ISNWFGQYMRASKDLQAADP- 172
                          |..|    ::.|.|::..:...|::     :.:|:.:.    ||.....| 
Mouse    98 --------------LWEHGPAGLLRSIGQNLAVHWGRYRSPGFHVQSWYDEV----KDYTYPYPH 144

  Fly   173 -----------SSNISSFRQLIQESSTHMGCGVLRQRSHMLW-----HQQFIVCNFA-RRNMPRE 220
                       ....:.:.|::..::..:||.|...|:..:|     :..::|||:: :.|...|
Mouse   145 ECTPRCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGE 209

  Fly   221 QVYQVGVAATGCRSGRNPRY-----PNLCALQEEYDVNAVDRFHSKRP 263
            ..|:.|...:.|.|.    |     .|||        :..::.|..:|
Mouse   210 APYKHGRPCSECPSS----YGGGCLNNLC--------HRAEKPHKHKP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 34/173 (20%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 34/175 (19%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.