DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Crisp4

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:239 Identity:52/239 - (21%)
Similarity:86/239 - (35%) Gaps:73/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHV 129
            |..||:..|.:|.:|:.       |||.|..|.|....|:.|.:.|:.|..| |.....||..:.
Mouse    85 QEEIVNTHNAFRRKVSP-------PARNMLKVSWSSAAAENARILARYCDKS-DSDSLERRLPNT 141

  Fly   130 GQLTGHVIFSAGKHSDLELLRHKISNW---------------FGQYMRASKDLQAADPSSNISSF 179
                     ..|::.   |:.|..|:|               :|::.....|::.       ..:
Mouse   142 ---------FCGENM---LMEHYPSSWSKVIEIWFNESKYFKYGEWPSTDDDIET-------DHY 187

  Fly   180 RQLIQESSTHMGCGVL---RQRSHMLWHQQFIVCNFARR-------NMPREQVYQVGVAATGCRS 234
            .|::..|:..:||.|.   ||::....:    ||::...       |||.::..........|..
Mouse   188 TQMVWASTYLVGCDVAACRRQKAATYLY----VCHYCHEGNHQDTLNMPYKEGSPCDDCPNNCED 248

  Fly   235 G--RNPRYPNLCALQEEYDVNAVDRFHSKRPLRIRFKYSASHPS 276
            |  .||     |...:||  |..|       .:::. |..|||:
Mouse   249 GLCTNP-----CIYYDEY--NNCD-------TQVKL-YGCSHPA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 36/165 (22%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.