DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Pi16

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:186 Identity:46/186 - (24%)
Similarity:73/186 - (39%) Gaps:43/186 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVI 137
            |.||.||:.       ||..|..:|||.|||..|:..|::| :.|......||.:::..:|    
Mouse    43 NQYRAQVSP-------PASDMLQMRWDDELAAFAKAYAQKC-VWGHNKERGRRGENLFAIT---- 95

  Fly   138 FSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHML 202
               .:..|:.|   .:.||..::...:......||:.....:.|::...:..:|||     ||..
Mouse    96 ---DEGMDVPL---AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCG-----SHFC 149

  Fly   203 WHQQ--------FIVCNF-ARRNMPREQVYQVGVAATGCRSG-----------RNP 238
            ...|        .:|||: ...|:...:.||.|...:.|..|           |||
Mouse   150 ETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCEPMRNP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 37/148 (25%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 37/147 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.