DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Crisp1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:87/243 - (35%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSNQL--------QAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLS 116
            |.|||        |..||...|.:|..|:.       |||.|..:.|....|:.|.:.|:.|..|
  Rat    33 LYNQLITESQTEPQEEIVDTHNAFRRNVSP-------PARNMLKMSWSSAAAENARILARYCDKS 90

  Fly   117 GDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHKISN----WFGQ--YMRASKDLQAADPSSN 175
             |.....||..:.         ..|::..:|......||    |:.:  |.:.. :..:.|....
  Rat    91 -DSDSLERRLPNT---------FCGENMHMENYPSSWSNVIEIWYNESKYFKYG-EWPSTDDDIE 144

  Fly   176 ISSFRQLIQESSTHMGCGVL---RQRSHMLWHQQFIVCNFARR-------NMPREQVYQVGVAAT 230
            ...:.|::..||..:||.|.   ||::....:    ||::...       |||.::.........
  Rat   145 TYHYTQMVWASSYLIGCDVASCRRQKAATYLY----VCHYCHEGNSQDTLNMPYKEGPPCQDCPN 205

  Fly   231 GCRSG--RNPRYPNLCALQEEYDVNAVDRFHSKRPLRIRFKYSASHPS 276
            .|..|  .||     |...:||  |..|:       :::. ...|||:
  Rat   206 NCEDGLCTNP-----CLYYDEY--NNCDK-------QVKL-LGCSHPA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 36/156 (23%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 36/157 (23%)
Crisp 200..254 CDD:285731 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344738
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.