DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and crispld2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:248 Identity:52/248 - (20%)
Similarity:94/248 - (37%) Gaps:67/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 REARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSG 117
            |..|.|..:::.:...:|  |..|.||...       |..|..:.||.||.:.||..|:.|.   
 Frog    47 RTRRAILRTDKEEIIQLH--NKLRGQVHPS-------ASNMEYMTWDDELEKSAEAWAEECI--- 99

  Fly   118 DGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHK-----ISNWFGQYMRASKDLQAADP----- 172
                    ::| |...  ::.|.|::..:...|::     :.:|:.:.    ||.....|     
 Frog   100 --------WEH-GPTA--LLMSIGQNLAVHWGRYRQPAYHVQSWYDEV----KDYTYPYPHECNP 149

  Fly   173 -------SSNISSFRQLIQESSTHMGCGVLRQRSHMLW-----HQQFIVCNFA-RRNMPREQVYQ 224
                   ....:.:.|::..::|.:||.|...:...:|     :..::|||:: :.|...|..|:
 Frog   150 YCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYK 214

  Fly   225 VGVAATGCRSGRNPRY-----PNLCAL------QEEYDVNAVD--RFHSKRPL 264
            .|...:.|    .|.|     .|||..      :|....|.|:  ||..:.|:
 Frog   215 NGRPCSEC----PPSYGGNCQNNLCYKGDKHYGREGIVTNEVETPRFPEETPV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 33/169 (20%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 33/171 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281 1/4 (25%)
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.