DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and pi15a

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:184 Identity:48/184 - (26%)
Similarity:82/184 - (44%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFS 139
            |.|:|..   ..|.||..|..:.||..||:.||..|..| :...|.||..||  :||   ::...
Zfish    75 YHNKVRG---KVFPPASNMEYMVWDDTLAKTAEQWASTC-IWEHGPRNLLRF--LGQ---NLSVR 130

  Fly   140 AGKH-SDLELLR---HKISNWFGQYMRASK---DLQAADPSSNISSFRQLIQESSTHMGCGVLRQ 197
            .|:: |.|:|::   .::.::...|.|...   .|:...|.  .:.:.|::..:|..:||.:...
Zfish   131 TGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPM--CTHYTQMVWATSNKVGCAINTC 193

  Fly   198 RSHMLW-----HQQFIVCNFA-RRNMPREQVYQVGVAATGCRSGRNPRYPNLCA 245
            .:..:|     ...::|||:: :.|...|..|:|||..:.|    .|.|...|:
Zfish   194 HNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMC----PPSYGGSCS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 38/149 (26%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 38/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.