DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and pi15b

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:243 Identity:58/243 - (23%)
Similarity:95/243 - (39%) Gaps:52/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WCPRSTDHVACNNNGTF-----GLDCG-------REARLIPLSNQLQAFIVHQVNFYRNQVASGG 83
            |..|:........|.||     |.|.|       |..|.|..|:.:      .:..|.|:|.:  
Zfish    22 WVIRNATETQTGTNLTFSTSELGDDQGIGSKPKSRRKRYISQSDMI------AILDYHNKVRA-- 78

  Fly    84 LSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRF--KHVGQLTGHVIFSAGKHSDL 146
             :.|.||..|..:.||..||:.||..|..| :...|.....|:  :::...||:.      .|.|
Zfish    79 -NVFPPAANMEYMLWDDGLARSAEAWAATC-IWEHGPPYLLRYLGQNLSVRTGNY------RSIL 135

  Fly   147 ELLRHKISNWFGQ---YM-RASKDLQAADP----SSNISSFRQLIQESSTHMGCGVLRQRSHMLW 203
            :|    :..|:.:   || ...:|.....|    ....:.:.|::..||..:||.:....:.::|
Zfish   136 QL----VKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVW 196

  Fly   204 -----HQQFIVCNFA-RRNMPREQVYQVGVAATGCRSGRNPRYPNLCA 245
                 ...::|||:: :.|...|..|:|||..:.|    .|.|...|:
Zfish   197 GAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSAC----PPSYGGSCS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 36/162 (22%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.