DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:175 Identity:35/175 - (20%)
Similarity:64/175 - (36%) Gaps:41/175 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PARRMASVRWDPELAQLAELAAKRCSLSGDGCRN-----TRRFKHVGQ---------LTGHVIFS 139
            ||..|..:.||..||:||:...:.|..|.:.|.:     |:.:.::|:         ....|:||
  Rat    59 PASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYDYIGENIYLGKIDARPEDVVFS 123

  Fly   140 AGKHSDLELLRHKISNWFGQYMRASKDLQAADP--SSNISSFRQLIQESSTHMGCGVLRQRSHML 202
                            |:.:    :||....|.  :.....:.|::...:..:||.: ....|:.
  Rat   124 ----------------WYNE----TKDYNFDDNTCTKTCGHYTQVVWAKTLKIGCAI-SNCPHLT 167

  Fly   203 WHQQ-FIVCNFA-RRNMPREQVYQVGVAATGCRSGRNPRYPNLCA 245
            .:.. ..|||:. ..|....:.|..|...:.|  |......:||:
  Rat   168 GYSAGLFVCNYVPAGNFQGSKPYIKGEPCSMC--GEKECVNSLCS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 28/140 (20%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 28/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.