DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Ag5r

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:134/256 - (52%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQV 72
            |:.:..::|....|.:.|||::. | .||.::.|:|||.:...|..:|.|:.||:..:..:|.:.
  Fly     4 FVIIFSLSLAFGIASATDYCKKS-C-GSTKNLGCDNNGAWASSCPSDATLLTLSSAEKDALVART 66

  Fly    73 NFYRNQVASGGLSA-FGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHV 136
            |.|||.:| |||:| ...|.|||:::|:.|||.||.|..|.|.:..|||.||..|...||....:
  Fly    67 NEYRNHIA-GGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDWSGQNLAWM 130

  Fly   137 IFSAGKHSDLEL---LRHKISNWFGQYMRASKDLQAADPSS----NISSFRQLIQESSTHMGCGV 194
                |.::.|.:   |...:..|:.:.:...:....|.||:    .|..|..|:.:.:|.:||..
  Fly   131 ----GYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAA 191

  Fly   195 LRQRSHMLWHQQFIV-CNFARRNMPREQVY-QVGVAATGCRSGRNPRYPNLCALQEEYDVN 253
            .........::.|:: ||:|..|:...::| ....||:.|.:|.||:|..||:.:|||:||
  Fly   192 ATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKEEYNVN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 47/156 (30%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 47/156 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440598
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.