DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG31482

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster


Alignment Length:118 Identity:22/118 - (18%)
Similarity:40/118 - (33%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHK---- 152
            |:......|.|....|| .|.|........|..:.:|..        |||::....|....    
  Fly    32 RLREKHGSPPLTLDDEL-TKGCEEYAKVLANNEKLEHSS--------SAGQNYGENLCMRSQTPL 87

  Fly   153 --ISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLW 203
              :.:|:.:.  |..|.:....:.:...|..|:.:::..||.|..:.:....|
  Fly    88 QCVQDWYDEI--ADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYW 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 22/118 (19%)
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 22/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455018
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.