DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG42564

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:236 Identity:82/236 - (34%)
Similarity:125/236 - (52%) Gaps:14/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGP 89
            |||....|.:...|||||.:......|..:|.||.:|.:::.|::.:.|..|:.||.||.:...|
  Fly    54 DYCDPSLCHKELKHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGLSP 118

  Fly    90 ARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLE-LLRHKI 153
            |.||.:::|:||||.|||...:.|.|..|.||||:..::.||..|:.... ||..:|| :||..|
  Fly   119 ASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGIK-GKLPELEDILRDII 182

  Fly   154 SNWFGQYMRASK-------DLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCN 211
            ..|..:..|.|.       :.::..|..|   |.|::.|::..:||.:::|..|. |.|.|..||
  Fly   183 GVWLREKSRTSMVNIMKYVEQESQSPKYN---FLQIVLENAESVGCAIVQQSRHG-WIQTFFACN 243

  Fly   212 FARRNMPREQVYQVG-VAATGCRSGRNPRYPNLCALQEEYD 251
            :....:....||:.| .||..|::|.||:|.:|||..|.|:
  Fly   244 YGHAPVVGSPVYEPGKKAAESCKTGANPKYAHLCAESEVYE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 53/155 (34%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 53/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440567
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.