DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and crisp1.7

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:213 Identity:44/213 - (20%)
Similarity:76/213 - (35%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ARLIPLS--------NQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAK 111
            |.:.|.|        |:.:...:|  |.||.       ||...|..|..:.|..|    ||..||
 Frog    18 AAVFPFSSLSTRYATNRQKIVDIH--NAYRR-------SANPTASNMLKMSWSIE----AENNAK 69

  Fly   112 RCSLSGDGCRNTRRFKHVGQLT-GHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSN 175
            ..:.:.:...:....:.:..:| |..:|.:...:..|   ..|.:...:|......:.|......
 Frog    70 NWATTCNQYHSQPAARQIANITCGENLFMSSYPASWE---EVIQSLHSEYDNFEYGVGAKAVGLV 131

  Fly   176 ISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVC------NFARR-NMPREQVYQVGVAATGCR 233
            |..:.|::...|..:||......:..:..:.:.||      |:|.| |.|    |:.|.:...|.
 Frog   132 IGHYTQVMWYKSYRIGCYCTECPNDGVRLKYYYVCQYYPAGNYADRINYP----YKSGPSCADCP 192

  Fly   234 SG-RNPRYPNLCALQEEY 250
            .. .|....|.|..:::|
 Frog   193 DACDNGLCTNPCPYEDQY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 29/154 (19%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 29/154 (19%)
Crisp 188..243 CDD:369954 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.