DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG8072

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:246 Identity:65/246 - (26%)
Similarity:107/246 - (43%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQV 72
            |:|.::. |.|..|.  |:|....| ....|:.|:||..|...|.|...|:.:: ..:.:::...
  Fly     9 FLCKILF-LRSILAI--DFCDIKSC-HGKRHIGCDNNMMFDESCLRFHGLVNMA-YFREYLLGLH 68

  Fly    73 NFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRC--SLSGDGCRNT-----RRFKHVG 130
            |.||.:|||.......||::|..:.||..|:.:||...|||  .|..|.|..|     ..|.:..
  Fly    69 NGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAE 133

  Fly   131 QLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVL 195
            ......:.......::.:|..       |::....||......|.....|.:|.:.|::|||.. 
  Fly   134 DFYPRPVIRQSNVREMTILAE-------QWLDELYDLDDIATYSAEGEIRNIINDRSSYMGCAA- 190

  Fly   196 RQRSHMLWHQQFI-VCNFARRNMPREQVYQVGV-AATGCRSGRNPRYPNLC 244
             .:.:.||:..|: ||.::........:|:.|: .||.|.:|::..|||||
  Fly   191 -GQDYDLWNIHFVLVCYYSSGPPVEGNLYEEGIFNATLCPNGQSDEYPNLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 38/155 (25%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.