DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG34002

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:112/249 - (44%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYCQEHWCP--RSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAF 87
            :||....||  :...|:.|||:|::...||::.::|.:...::..|::..|.||:.||.|.:...
  Fly    27 NYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHHNTYRDIVAGGQMHRL 91

  Fly    88 GPARRMASVRWDPELAQLAELAAKRCSLS-GDGCRNTRRFKHVGQLTGHVIFS--AGKHSDLELL 149
            ..|.||..::||.|||.||.:..|||.|. .|.|.:|..|.....   |.:::  ..|.....::
  Fly    92 PIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSY---HAVYNKFKAKEDTFRIV 153

  Fly   150 RHKISNWFGQYMRASKD-----LQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIV 209
            |.:::.|:.||...|..     |..|  ...|..|.::|...|..:||.:....... |..|::.
  Fly   154 RSQLNAWYDQYKHVSSSSLIDGLSTA--KKEIGHFLRMIVGPSNRLGCAIASIEKGG-WTHQWLA 215

  Fly   210 CNFARRNMPREQVYQV-GVAATGCRSGRNPRYPNLCALQEEYDVNAV-DRFHSK 261
            |.::........:|:. |.....|.:|.|.::.|||     .|...| |..||:
  Fly   216 CLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLC-----NDTEPVKDCMHSE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 43/155 (28%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455070
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.