DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG34049

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:165 Identity:39/165 - (23%)
Similarity:63/165 - (38%) Gaps:45/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IPLSNQ--LQAFIVHQVNFYRNQVASGGLSAFGPAR---RMASV--RWDPELAQLAELAAKRCSL 115
            ||:..:  ::..::.:.|.||.      |....|.:   ::.|.  .|...||.|.:|..:...|
  Fly   137 IPIIRRKPIKQAVLRETNKYRR------LHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPL 195

  Fly   116 SGDGCRNTRRFK-HVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNI--S 177
            .|:.....||.| .|.|:             |:|...:..|:  .|::         |..|:  .
  Fly   196 YGENIMRVRRSKFSVDQI-------------LKLWYQEKYNY--DYLK---------PGFNLYTG 236

  Fly   178 SFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNF 212
            .|.||:...|..:|.||....| .:|    ||||:
  Fly   237 HFTQLVWRESEFLGVGVACDVS-SIW----IVCNY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 37/156 (24%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 37/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.