DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Glipr2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_081726.1 Gene:Glipr2 / 384009 MGIID:1917770 Length:154 Species:Mus musculus


Alignment Length:138 Identity:24/138 - (17%)
Similarity:51/138 - (36%) Gaps:30/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRR 125
            |.|....::...|.||   |..|:......:::     :.|..|.:|..|           :||.
Mouse     6 SKQFNNEVLKAHNEYR---AQHGVPPLKLCKKL-----NREAQQYSEALA-----------STRI 51

  Fly   126 FKHV-----GQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQE 185
            .||.     ||...::.:::...:..::    ...|:.:.  .|.:.|....:|....|..::.:
Mouse    52 LKHSPESSRGQCGENLAWASYDQTGKDV----ADRWYSEI--KSYNFQQPGFTSGTGHFTAMVWK 110

  Fly   186 SSTHMGCG 193
            ::..:|.|
Mouse   111 NTKKIGVG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 22/134 (16%)
Glipr2NP_081726.1 CAP_GAPR1-like 8..139 CDD:349401 23/136 (17%)
Interaction with CAV1. /evidence=ECO:0000250 91..98 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.