DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG17974

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:268 Identity:81/268 - (30%)
Similarity:121/268 - (45%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICLVIVTLNSFPA-----YSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFI 68
            |||.|..| .|..     |||  |....|.....|:||...|.|...|..:|..:.:|.. :|..
  Fly     6 ICLAIFQL-IFQLILAKDYSW--CDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRH-KADF 66

  Fly    69 VHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLT 133
            :|..|..||.:|.|.:..:.||.|||::.||.||..|:.|..:.|.|..|.|.||.|:.:.||..
  Fly    67 LHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNL 131

  Fly   134 GHVIFSAGKHSDL-ELLRHKISNWFGQYMRASKDLQAADPSSNISSFR------------QLIQE 185
            ..|......|.:: .|:...:..||.::     ||   ..||.|.||:            :|..:
  Fly   132 CAVWRPRSPHVNVTSLVEECLGLWFNEF-----DL---IDSSFIDSFKVTPIFEDYGHFAELSVD 188

  Fly   186 SSTHMGCGVLR-----QRSHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCA 245
            .:..:||.::|     ..|..:::   .:||:|........||:.|.||:.|.:|::..||.||:
  Fly   189 KNFAVGCSIMRFTRPDYPSVYIYN---FICNYASLYALGAPVYETGRAASRCTTGKSHFYPGLCS 250

  Fly   246 LQEEYDVN 253
            .:|.||.|
  Fly   251 TREVYDPN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 46/165 (28%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 46/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440596
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.