DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and R3hdml

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:185 Identity:51/185 - (27%)
Similarity:82/185 - (44%) Gaps:32/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQ-LTGHVIF 138
            |.|.:.:   |...||..|..:.||.:||:.||..|.:|..:....:.|   |:||| |:.|   
  Rat    69 YHNHIRA---SVHPPASNMEYMVWDEQLARAAEAWATQCIWAHGPSQLT---KYVGQNLSVH--- 124

  Fly   139 SAGKHSDLELLRHKISNWFGQYMR----ASKDLQAADP---SSNI-SSFRQLIQESSTHMGCGVL 195
             :|::..:..|   :.:|..:...    |.||.....|   |..: |.:.|::..||:.:||.:.
  Rat   125 -SGRYRSVVDL---VKSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAIH 185

  Fly   196 RQRSHMLW---HQQ--FIVCNFA-RRNMPREQVYQVGVAATGCRSGRNPRYPNLC 244
            ...|..:|   .||  ::|||:| :.|...|..|:.|...:.|    .|.|...|
  Rat   186 TCSSINVWGSTWQQAVYLVCNYAIKGNWIGEAPYKTGKPCSAC----PPSYQGNC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 42/151 (28%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.