DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG10651

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:282 Identity:71/282 - (25%)
Similarity:116/282 - (41%) Gaps:74/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGRE-ARLIPLSNQLQAFIV 69
            :|.:...:...::..:..|  |:...|  ...||.|::||.|...|.:: |.::.:|..:.|.||
  Fly     5 IWLLFSTLYIQDTGASDKW--CKADLC--RGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIV 65

  Fly    70 HQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTG 134
            .:.|.|||:.| ||:.....|.||.::.||||||::|:...:||....|.|..|..:.|     .
  Fly    66 DKHNEYRNKFA-GGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH-----A 124

  Fly   135 HVIFSAGKH----SDLELLRHKISNWFGQYMRASKDLQAADPSSN-----------------ISS 178
            .|.:|..|:    :..|.||.::.:||             ||:|.                 ..:
  Fly   125 EVSYSLEKYFCMTTKKEALRKQLDHWF-------------DPNSKDEVQKLFFSWTKNQQELSKN 176

  Fly   179 FRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQVYQVGV---------------- 227
            :.|::::.:..:||.::......|.| |.:.|           ||..||                
  Fly   177 YFQVLRDRANRVGCAIVEYVRPALVH-QLLKC-----------VYNCGVSLCEEEDNPVYEDTDE 229

  Fly   228 -AATGCRSGRNPRYPNLCALQE 248
             ||:.|..|.|.:|.|||...|
  Fly   230 EAASECMKGSNKQYKNLCHKDE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 44/168 (26%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 45/179 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440679
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.