DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG16995

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:98 Identity:25/98 - (25%)
Similarity:44/98 - (44%) Gaps:29/98 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LRHKISNWFGQ--YMRASKDLQAAD----------------PS--SNISSFRQLIQESSTHMGCG 193
            :.|:.::.:|:  ||.:..:|:.||                ||  .|...|.|::.:|||.:|.|
  Fly    49 MEHRQNSGYGENIYMASGGNLKGADAVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVG 113

  Fly   194 VLRQRSHMLWHQQFIVCNF----ARRNMPREQV 222
            ..:..|.:     ::|||:    ...|:.||.|
  Fly   114 FAKSGSTI-----YVVCNYNPPGNYNNLFRENV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 21/87 (24%)
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.