DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG31296

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:261 Identity:73/261 - (27%)
Similarity:116/261 - (44%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVIVTLNSFP---AYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQV 72
            :.:..||..|   :...|:||..:|  .|:::||||...|.:.|...||.:.:|......:: ..
  Fly     7 IFVALLNFIPFGCSKLVDFCQLPYC--GTNNLACNNPSKFSVMCPPNARTLSMSTYRNLLLI-AF 68

  Fly    73 NFYRNQVASGG---LSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTG 134
            |.:||..|||.   |.|  .|.||:.:.:..||..||.||...|| :...|.|::.|.:||...|
  Fly    69 NEFRNYTASGKQKYLKA--AAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQEFYYVGTNIG 130

  Fly   135 --HVIFSAGKHSDLELLRHKISNW----------FGQYMRASKDLQAADPSSNISSFRQLIQESS 187
              |.:.:...:.||||:...|.:|          .|.||..:..      .|.|:....|:.:.:
  Fly   131 STHYLGNLNDYEDLELMLRIIQHWTRYADYVNIKMGVYMPTTLG------KSGIAKALLLMADRN 189

  Fly   188 THMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCALQEEYDV 252
            ||:||..:|...|.: |....:|.|:........:|::.:.........:|.|..|||:.|.|:.
  Fly   190 THVGCSAMRFTVHSV-HNFVFLCAFSTDLFVERPIYRMSMRPGAACKRLDPTYSALCAVGENYEN 253

  Fly   253 N 253
            |
  Fly   254 N 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 46/162 (28%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 46/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.