DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CG31286

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:103 Identity:24/103 - (23%)
Similarity:35/103 - (33%) Gaps:38/103 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NTRRFKH-VGQLTGHVIFSAG--------------KHSD------------LELLRHKIS----N 155
            |.||.:| |.:||...:.|.|              .:||            .|:.|..:|    |
  Fly    37 NKRRDRHGVPKLTLDNVLSKGCQSYAWKLSKSATLNYSDPTNKDYTESICRFEVKRGALSRCVKN 101

  Fly   156 WFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCG 193
            |:.     .:.....||.:  ..|..:|..||..:|.|
  Fly   102 WYN-----GRKFDILDPKA--KDFTAMIWRSSVSLGYG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 24/103 (23%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.