DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Glipr1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:218 Identity:52/218 - (23%)
Similarity:83/218 - (38%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLT 133
            ||  |.:|::       |:.||..|..:.|||:|||:|:..|:.|.           |:|..||.
  Rat    40 VH--NHFRSK-------AYPPAGNMLYMSWDPKLAQIAKAWAQSCV-----------FQHNPQLH 84

  Fly   134 G--HVIFSA-GKH---SDLEL--LRHKISNWF--GQYMRASKDLQAADPSSNISSFRQLIQESST 188
            .  |..|:. |::   ..|.|  :|..|..||  .||.    |............:.|::...|.
  Rat    85 SRIHPNFTGLGENIWLGSLSLFSVRAAILAWFEESQYY----DFSTGKCKKVCGHYTQIVWADSY 145

  Fly   189 HMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPR----YPNLCALQEE 249
            .:||.|     .:.......:||:..........|:.|...:.|     |:    ..|||...:.
  Rat   146 KIGCAV-----QLCPRGANFICNYGPAGNYPTWPYKQGATCSAC-----PKDDKCLNNLCTNPQR 200

  Fly   250 YDVNAVDRFHSKRPLRIRFKYSA 272
               :.|.|..:..|..:|.:|::
  Rat   201 ---DQVSRHSADYPKYLRNRYTS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 40/153 (26%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.