DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Pi16

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:172 Identity:43/172 - (25%)
Similarity:69/172 - (40%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVI 137
            |.||.||:.       ||..|..:|||.|||..|:..|::| :.|......||.:::..:|    
  Rat    47 NHYRAQVSP-------PASDMLQMRWDDELAAFAKAYAQKC-VWGHNKERGRRGENLFAIT---- 99

  Fly   138 FSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHML 202
               .:..|:.|   .:.||..::...:......||......:.|::...:..:|||     ||..
  Rat   100 ---DEGMDVPL---AVGNWHEEHEYYNLSTATCDPGQMCGHYTQVVWSKTERIGCG-----SHFC 153

  Fly   203 WHQQ--------FIVCNF-ARRNMPREQVYQVGVAATGCRSG 235
            ...|        .:|||: ...|:...:.||.|...:.|..|
  Rat   154 ETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 37/148 (25%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 37/147 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.