DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CLEC18C

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:173 Identity:40/173 - (23%)
Similarity:65/173 - (37%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHWCPRSTDHV----ACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGP 89
            |.|.|:..:..    |.|...:|        .|:.|.|:|::::.                  .|
Human    27 EVWPPQLQEQAPMAGALNRKESF--------LLLSLHNRLRSWVQ------------------PP 65

  Fly    90 ARRMASVRWDPELAQLAELAAKRCSLS----GDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLR 150
            |..|..:.|...|||||:..|..|.:.    ..|...|.:.....||     ..||..|.:|:  
Human    66 AADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQL-----LPAGLASFVEV-- 123

  Fly   151 HKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCG 193
              :|.||.:..|.|........::..:.:.||:..:|:.:|||
Human   124 --VSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCG 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 30/133 (23%)
CLEC18CNP_775890.2 SCP_euk 50..183 CDD:240180 34/142 (24%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.