DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and antr

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:265 Identity:68/265 - (25%)
Similarity:127/265 - (47%) Gaps:22/265 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRVWFICLVIVTLNSFPAYSWD-YCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAF 67
            :::|::.|.::.|.:......| :|:.:.|..|..||.|......|..||:....:.::..|:..
  Fly     1 MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTG 65

  Fly    68 IVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQL 132
            |:.::|..||.||| |:..:..|.||.::.||.||.:||:...::|..:|..|.||.::.:|.  
  Fly    66 ILSRINMLRNYVAS-GVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVA-- 127

  Fly   133 TGHVIFSAGKHSDL------ELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMG 191
            |..:....|:...|      :||.....:..|..|.:.| |......:.:..:..|||:..:.||
  Fly   128 TTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQK-LVPVREGTCVGHYMPLIQDHGSRMG 191

  Fly   192 CGVL-----RQRSHMLWHQQFIVCNFARRNMPREQVYQVG-VAATGCRSGRNPRYPNLCALQEEY 250
            ||:.     .:.|:::     ::|:|:|.::.....|:.| :.|..|.:|.:..|..||:..|..
  Fly   192 CGLRVKGRDEKESNII-----LLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYV 251

  Fly   251 DVNAV 255
            |.|::
  Fly   252 DANSM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 41/158 (26%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440673
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.