DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Crisp2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:195 Identity:43/195 - (22%)
Similarity:78/195 - (40%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSNQLQA--FIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRN 122
            |:||||.  .||::.|..|..|...|..       :..:.|..:....|:..|.:|.|.    .:
Mouse    31 LTNQLQVQREIVNKHNELRRSVNPTGSD-------ILKMEWSIQATTNAQKWANKCILE----HS 84

  Fly   123 TRRFKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDL---QAADPSSNISSFRQLIQ 184
            ::..:.:....|..::.:   :|..|....|.:|:.:    ::|.   ..|.|:|.:..:.||:.
Mouse    85 SKDDRKINIRCGENLYMS---TDPTLWSTVIQSWYNE----NEDFVYGVGAKPNSAVGHYTQLVW 142

  Fly   185 ESSTHMGCGV--LRQRSHMLWHQQFIVCNF---ARRNMPREQVYQVGVAATGCRSGRNPRYPNLC 244
            .||..:|||:  ...:.::   :.|.||::   ....|.:...||.|.....|        ||.|
Mouse   143 YSSFKIGCGIAYCPNQDNL---KYFYVCHYCPMGNNVMKKSTPYQQGTPCASC--------PNNC 196

  Fly   245  244
            Mouse   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 31/157 (20%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 31/155 (20%)
Crisp 189..243 CDD:285731 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841362
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.