DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and scl-11

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_502499.1 Gene:scl-11 / 186050 WormBaseID:WBGene00009892 Length:207 Species:Caenorhabditis elegans


Alignment Length:204 Identity:47/204 - (23%)
Similarity:76/204 - (37%) Gaps:42/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QAFIVHQVNFYRNQVASGGLSAFGPARR----MASVRWDPELAQLAELAAKRCSLSGDGCRNTRR 125
            |..||...|..|:.:|.|...|.|..::    |..::||..:|..|:..|..|.           
 Worm    23 QQAIVDAHNKLRSSIAKGTYVAKGTTQKSGSNMRKIKWDATVATSAQNYANTCP----------- 76

  Fly   126 FKHVGQLTGHV-----------IFSAGKHSDLELLRHKI-SNW---FGQYMRASKDLQAADPSSN 175
                   |||.           .:::|...:|:...... |:|   |.||...|..|.....::.
 Worm    77 -------TGHSQGSGYGENLYWYWTSGTIGNLDTFGPAASSSWESEFQQYGWTSNTLDMNTFNTG 134

  Fly   176 ISSFRQLIQESSTHMGCGVL---RQRSHMLWHQQFIVCNF-ARRNMPREQVYQVGVAATGCRSGR 236
            |....|:...::..:||||.   :..|:. :::..:||.: ...|...:.:||.|.....|.||.
 Worm   135 IGHATQMAWANTFAIGCGVKNCGKDPSNG-YNKVAVVCQYKTPGNYLNQPIYQQGTTCAACPSGT 198

  Fly   237 NPRYPNLCA 245
            ......|||
 Worm   199 ACDSSGLCA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 37/170 (22%)
scl-11NP_502499.1 SCP 21..173 CDD:214553 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.