Sequence 1: | NP_611950.1 | Gene: | CG3640 / 37942 | FlyBaseID: | FBgn0035042 | Length: | 296 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300377.1 | Gene: | vap-2 / 181273 | WormBaseID: | WBGene00011462 | Length: | 507 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 37/206 - (17%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 44/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 NNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVA-----SGGLSAFGP-ARRMASVRWDP 100
Fly 101 ELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASK 165
Fly 166 DLQA-ADPSSN-------------ISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFA-RR 215
Fly 216 NMPREQVYQVG 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3640 | NP_611950.1 | SCP_euk | 65..213 | CDD:240180 | 30/167 (18%) |
vap-2 | NP_001300377.1 | SCP | 104..253 | CDD:214553 | |
SCP | 315..468 | CDD:214553 | 30/169 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |