DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and vap-2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:206 Identity:37/206 - (17%)
Similarity:80/206 - (38%) Gaps:44/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVA-----SGGLSAFGP-ARRMASVRWDP 100
            ::.|:|..|...      :|:..:.|.:.|.||||:::|     :|..:...| |.:|..:.:|.
 Worm   299 DDGGSFQCDNSL------VSDVTRNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDC 357

  Fly   101 ELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASK 165
            .|.:.|:..|..|..:     ::..::...|.....:.|........|:...:..|:       :
 Worm   358 MLERFAQNWANNCVFA-----HSAHYERPNQGQNLYMSSFSNPDPRSLIHTAVEKWW-------Q 410

  Fly   166 DLQA-ADPSSN-------------ISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFA-RR 215
            :|:. ..|..|             |..:.|:..:.:..:|||:.....     ..::||::. ..
 Worm   411 ELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCPK-----MSYVVCHYGPAG 470

  Fly   216 NMPREQVYQVG 226
            |....::|::|
 Worm   471 NRKNNKIYEIG 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 30/167 (18%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 30/169 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.