DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and lon-1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:254 Identity:59/254 - (23%)
Similarity:92/254 - (36%) Gaps:74/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 STDHVACNNNG-----TFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMA 94
            :||.|.....|     .|..|.|..:|....:..|:.:|.|:.|.||..|         ||..|.
 Worm    46 ATDEVKREKRGYFFPSHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMV---------PASDMN 101

  Fly    95 SVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHV-GQL-TGHVIFSA--GKHSDLELLRHKISN 155
            .:.|..|||..|:..|..|.           |:|. |:: .|..|::|  ..:||      .||.
 Worm   102 MLYWSDELAASAQRHADTCD-----------FRHSRGRINVGENIWAAPYSNYSD------AISI 149

  Fly   156 WFGQYMRASKDLQAADPSSNIS--------SFRQLIQESSTHMGCGVLRQRS-HMLW---HQQFI 208
            ||.         :..:|....:        .:.|::...:..:|||..|.|. ..:|   |:...
 Worm   150 WFN---------EVHNPRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVF 205

  Fly   209 VCNFARRN-----MPREQVYQVGVAATGCRSGRNPR-----------YPNLCALQEEYD 251
            ||::..:.     ..|.|:|  .:.|....||.|.:           |..||.:.:.|:
 Worm   206 VCHYNPQGNTVFVTARGQLY--AMPAFTWASGDNGKCSNCPANAPACYQGLCYMPKNYE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 39/163 (24%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.