DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and GLIPR2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:177 Identity:33/177 - (18%)
Similarity:60/177 - (33%) Gaps:39/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNT 123
            |.|.|....::...|.||.:.....|.......|        |..|.:|..|           :|
Human    19 PASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNR--------EAQQYSEALA-----------ST 64

  Fly   124 RRFKHV-----GQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADP--SSNISSFRQ 181
            |..||.     ||...::.:::...:..|:    ...|:.:.    |:.....|  :|....|..
Human    65 RILKHSPESSRGQCGENLAWASYDQTGKEV----ADRWYSEI----KNYNFQQPGFTSGTGHFTA 121

  Fly   182 LIQESSTHMGCGVLRQRSHMLWHQQFIVCN-FARRNMPREQVYQVGV 227
            ::.:::..||.|    ::.......|:|.. |...|:..|..::..|
Human   122 MVWKNTKKMGVG----KASASDGSSFVVARYFPAGNVVNEGFFEENV 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 26/155 (17%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 28/161 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.