DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:228 Identity:47/228 - (20%)
Similarity:81/228 - (35%) Gaps:57/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ARLIPLSNQLQAFIVHQVNFY---RNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLS 116
            ||.:|....:. ||...||.:   |..|...|       ..:..:.||..|::.|....|:|   
Human    42 ARFLPDEEDVD-FINEYVNLHNELRGDVIPRG-------SNLRFMTWDVALSRTARAWGKKC--- 95

  Fly   117 GDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHKI-----SNWFG-----------QYMRASK 165
                           |..|.|:.    .|::::..|.     :.|.|           :...|.|
Human    96 ---------------LFTHNIYL----QDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEK 141

  Fly   166 ---DLQAADPSSNISSFRQLIQESSTHMGCGV--LRQRSHMLWHQQFIVCNFARRNMPREQVYQV 225
               :.:....|.:.|::.||:.:.|..:||.|  ..:..|:: |....:||:|.......:.|:.
Human   142 KMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHII-HAAIFICNYAPGGTLTRRPYEP 205

  Fly   226 GVAATGCRSGRNPRYPNLCALQEEYDVNAVDRF 258
            |:..|.|  ||..:..:......:.|.....||
Human   206 GIFCTRC--GRRDKCTDFLCSNADRDQATYYRF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 34/171 (20%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 35/173 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.