DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and R3HDML

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:225 Identity:55/225 - (24%)
Similarity:92/225 - (40%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNF---YRNQVASGGLSAFGPARRMA 94
            |.:|...|...:....|..|.|   :|...:.:...|..:|.   |.|.:.:   |.:.||..|.
Human    27 PNATPAPAQPESTAMRLLSGLE---VPRYRRKRHISVRDMNALLDYHNHIRA---SVYPPAANME 85

  Fly    95 SVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQ 159
            .:.||..||:.||..|.:| :...|  .::..::|||...  |.|....|.::|::......:..
Human    86 YMVWDKRLARAAEAWATQC-IWAHG--PSQLMRYVGQNLS--IHSGQYRSVVDLMKSWSEEKWHY 145

  Fly   160 YMRASKDLQAADP----SSNISSFRQLIQESSTHMGCGVLRQRSHML----WHQ-QFIVCNFA-R 214
            ...|.:|.....|    ....|.:.|::..||..:||.:....|..:    ||: .::|||:| :
Human   146 LFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIK 210

  Fly   215 RNMPREQVYQVGVAATGCRSGRNPRYPNLC 244
            .|...|..|::|...:.|    .|.|...|
Human   211 GNWIGESPYKMGKPCSSC----PPSYQGSC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 39/159 (25%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.