DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Crisp1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:229 Identity:45/229 - (19%)
Similarity:76/229 - (33%) Gaps:71/229 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DCGREARLIPLSN---QLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAK 111
            |..:|.||..||.   .:|..||.:.|..|..|:..|..       :..:.|:.:....|:..|.
Mouse    21 DSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSD-------LLKMEWNYDAQVNAQQWAD 78

  Fly   112 RCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLEL----LR---------------HKISNWF 157
            :|:.|                          ||.:||    ||               ..|..|:
Mouse    79 KCTFS--------------------------HSPIELRTTNLRCGENLFMSSYLASWSSAIQGWY 117

  Fly   158 GQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQV 222
            .:|...:.|:....|.|.:..:.|::..|:..:.|||.....:.|  :.:.||::......:.::
Mouse   118 NEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPL--RYYYVCHYCPVGNYQGRL 180

  Fly   223 YQVGVAATGCRS--------------GRNPRYPN 242
            |....|...|.|              |...:|.|
Mouse   181 YTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 32/166 (19%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 32/169 (19%)
Crisp 190..244 CDD:285731 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.