DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and LOC100497187

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_017945658.1 Gene:LOC100497187 / 100497187 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:170 Identity:36/170 - (21%)
Similarity:59/170 - (34%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 STDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWD 99
            ||:...|:   .|....|.:..|.    |.|....|  |.||.:            ..:..:|.:
 Frog    47 STEFSTCS---AFPSRRGADENLF----QTQFLEAH--NKYRKK------------HNVPPMRLN 90

  Fly   100 PELAQLAE------LAAKRCSLSGDGCRNT-RRFKHVGQ-LTGHVIFSAGKHSDLELLRHKISNW 156
            .||::.|:      |:..:...||.|..|. ..:...|: |.|:|...|               |
 Frog    91 AELSKSAQTWANHLLSINKMQHSGAGGENLYYSYSSRGRTLAGNVAVDA---------------W 140

  Fly   157 FGQYMRASKDLQAADPSSNISS--FRQLIQESSTHMGCGV 194
            :.:.    ||.....|....::  |.|::.:.|..:|.||
 Frog   141 YNEV----KDYDYNKPGFKAATGHFTQVVWKDSKELGVGV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 29/140 (21%)
LOC100497187XP_017945658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.