DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and crispld1a

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:324 Identity:63/324 - (19%)
Similarity:118/324 - (36%) Gaps:89/324 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FICLVIVTLNS---FPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIV 69
            |:.||..|:.:   |.|....:..|.:.....|    ::.|...::..|..|.|..|:......:
Zfish    13 FLLLVTRTVFAMVLFNATDLGFLLEKYLEDDAD----DDAGDRVMERQRGKRAITASDMQAILDL 73

  Fly    70 HQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTG 134
            |  |..|.||       :.||..|..:.||.||.:.||..|:.|                     
Zfish    74 H--NKLRGQV-------YPPASNMEYMVWDNELERSAEEWAETC--------------------- 108

  Fly   135 HVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQA---------------ADPSSNI-------S 177
              ::..|....|..:...:...:|:|...:..:||               .:|....       :
Zfish   109 --LWEHGPAGLLPQIGQNLGVHWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCT 171

  Fly   178 SFRQLIQESSTHMGCGVLRQRSHMLWHQ-----QFIVCNFA-RRNMPREQVYQVGVAATGC---- 232
            .:.||:..:|:.:||.:....:..:|.|     .::|||:: :.|......|:.|.:.:.|    
Zfish   172 HYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPPSY 236

  Fly   233 -----------RSGRNPRYPNLCALQEEYDVNAV--DRFHSKRPLRIRFKYSASHPSKVLGADR 283
                       ..|:|.:.|:    :|.::.|::  :..||..| |:|......||:.|:..::
Zfish   237 GGVCRENLCYKGDGKNRQSPS----EETHERNSIEPEAPHSPGP-RLRPPSPTRHPNAVVSKEQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 33/174 (19%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 33/175 (19%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585691
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.