DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and XB5812873

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:189 Identity:42/189 - (22%)
Similarity:72/189 - (38%) Gaps:39/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSNQLQA---FIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCR 121
            :|..|::   |||.:.|:||:.|..       ||..|..:.||......|:..|..||       
 Frog    59 MSTDLESNRNFIVDKHNYYRSWVNP-------PAADMLKMHWDNYYLAKAKEWALTCS------- 109

  Fly   122 NTRRFKHV--------GQLTG-HVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNIS 177
                |||.        |:..| :::.|..:||    ..:.|:.||.:::.....:......:...
 Frog   110 ----FKHSNLSFRQYGGEFAGENIMNSYFRHS----WEYVINYWFNEHVNWEYAVGTTKEGAVTG 166

  Fly   178 SFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQV---YQVGVAATGCR 233
            .|.|:|...:..:.|.|  .:.:...:..|.||.:.......::|   ||.|.....|:
 Frog   167 HFTQIIWAPTHALACYV--AKCYGTPYNYFYVCIYYPTGNREDKVKTPYQNGTTCGLCQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 35/159 (22%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 35/159 (22%)
Crisp 219..269 CDD:400739 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.