DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and R3hdml

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:184 Identity:51/184 - (27%)
Similarity:80/184 - (43%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFS 139
            |.|.:.:   |...||..|..:.||.:||:.||..|.:|..:..   .::..|:|||...  |.|
Mouse    69 YHNHIRA---SVHPPAANMEYMVWDEQLARSAEAWATQCIWTHG---PSQLMKYVGQNLS--IHS 125

  Fly   140 AGKHSDLELLRHKISNWFGQYMR----ASKDLQAADP---SSNI-SSFRQLIQESSTHMGCGVLR 196
            ....|.::|:|    :|..:...    |.||.....|   |..: |.:.|::..||:.:||.:..
Mouse   126 GRFRSVVDLVR----SWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINT 186

  Fly   197 QRSHMLW---HQQ--FIVCNFA-RRNMPREQVYQVGVAATGCRSGRNPRYPNLC 244
            ..|..:|   .||  ::|||:| :.|...|..|:.|...:.|    .|.|...|
Mouse   187 CSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSAC----PPSYQGNC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 42/150 (28%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 42/150 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.