DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and ERG5

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_013728.1 Gene:ERG5 / 855029 SGDID:S000004617 Length:538 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:67/307 - (21%)
Similarity:132/307 - (42%) Gaps:30/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 YILMPKLMKALRVP-VMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIH------LLMEAQRQFKA 287
            |.|:...::.:..| ::......|.||....|||..:..:.:..|.|.      .:|:|..:...
Yeast   240 YYLVTAALELVNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMH 304

  Fly   288 EQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMN-PEVQEKLLAEILA 351
            :.:.|.:..::....||.:.: :::.:..|....:..::.|:...::::.: |:|..|:..|.||
Yeast   305 DAKNSNDDDSRIYHREFTNKE-ISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLA 368

  Fly   352 VKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDE----EGEVVVNLRE 412
            |:.......|:.|.:..|||.|.|:.|:||..||..:|..:...:|.:...    :|.:::....
Yeast   369 VRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLY 433

  Fly   413 DDLVHINVGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSL 477
            ..|         |||:.:..|::|.|||:.|..|....:..:|.||.|...|:|....::...:|
Yeast   434 PAL---------HDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAAL 489

  Fly   478 I--FQLVLRYHLKPTDRTPADMMSSISGF-RLLPRELFWCKLESRGP 521
            :  |.|...:|     .|...:...|..| .:.|::......:.|.|
Yeast   490 LGKFALYTDFH-----HTVTPLSEKIKVFATIFPKDDLLLTFKKRDP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 65/298 (22%)
ERG5NP_013728.1 CYP61_CYP710 103..522 CDD:410703 65/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.