DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:468 Identity:121/468 - (25%)
Similarity:202/468 - (43%) Gaps:79/468 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GVFNLR-DPLYYL--SDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMR 135
            |:|.|. .|..:|  |||.:.:.: :|  |....:.|||.....| .|:.|.|:......|::.|
plant   141 GIFRLTFGPKSFLIVSDPSIAKHI-LK--DNAKAYSKGILAEILD-FVMGKGLIPADGEIWRRRR 201

  Fly   136 STLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGT---SELELKDFFTRYTNDVIATAAFGI 197
            ..:.|......:..|..|..    ||.|.:.::|||..   .|:|::..|:|.|.|:|..|.|..
plant   202 RAIVPALHQKYVAAMISLFG----EASDRLCQKLDAAALKGEEVEMESLFSRLTLDIIGKAVFNY 262

  Fly   198 QVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALR-VPVMDMNNVDYFKKLVFGAM 261
            ..:|..:..                |.::.:..:|.....:::. :||.|   :..:|.:   :.
plant   263 DFDSLTNDT----------------GVIEAVYTVLREAEDRSVSPIPVWD---IPIWKDI---SP 305

  Fly   262 KYRKEQSIVR------PDMI----HLLMEAQRQFKAEQEGSAESA------AQQDKAEFND--DD 308
            :.||..:.::      .|:|    .::.|.:.||..|.....:.:      |..|......  ||
plant   306 RQRKVATSLKLINDTLDDLIATCKRMVEEEELQFHEEYMNERDPSILHFLLASGDDVSSKQLRDD 370

  Fly   309 LLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKPLDYDTLMGMKYLN 373
            |:...:    ||.||.|..|::|.|.|...|.|..||..|:.:|   :|::......:..:||..
plant   371 LMTMLI----AGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSV---IGDRFPTIQDMKKLKYTT 428

  Fly   374 CVVSESLRKWP-PAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFR 437
            .|::||||.:| |..::.|...:|..     ||..:...||  :.|:|..||..|.::.:.|:|.
plant   429 RVMNESLRLYPQPPVLIRRSIDNDIL-----GEYPIKRGED--IFISVWNLHRSPLHWDDAEKFN 486

  Fly   438 PERF--DEEHKHEIRQ-FTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLK------PTDRT 493
            |||:  |..:.:|..| |:|||||.|.|.|||:..|..|....|..|:.|::.:      |...|
plant   487 PERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMT 551

  Fly   494 PADMMSSISGFRL 506
            ....:.:..|.:|
plant   552 TGATIHTTEGLKL 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 121/468 (26%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 121/468 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.