DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:314 Identity:74/314 - (23%)
Similarity:123/314 - (39%) Gaps:77/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFVELSIFVAFIGLLL-YKWSVYTF---------GYFSKRGVAHEKPIPLLGNIPWSVLMG--K 53
            ::.|.....:.|:.|:| :.|....:         .|..|:|.:        || .:.:|||  :
plant     4 IITVRKVFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFS--------GN-SYRILMGDMR 59

  Fly    54 ES----YIKHSIDL---------------HLRLKQHKV----YGVFNLRDPLYYLSDPELIRQVG 95
            ||    .:.||:.|               |..||..|.    ||.:    |...:.|||.:|::.
plant    60 ESNQMDQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPY----PNVIVMDPETLREIM 120

  Fly    96 IKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVE 160
            .|: :.|...:.|     :...|....||:....:|.:.||.|.|.|....::.:....:....|
plant   121 SKH-ELFPKPKIG-----SHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKE 179

  Fly   161 AVDFVQRQLDA-GTSELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGG 224
            .::..:|...| ||.||:........|.:::|.|:||   :|:|| ..:.|.|.|...:.    |
plant   180 MLEEWERLASAKGTMELDSWTHCHDLTRNMLARASFG---DSYKD-GIKIFEIQQEQIDL----G 236

  Fly   225 LKVMLYILMP-------KLMKALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVR 271
            |..:..:.:|       |..:.||....||       :.:|.||...||:.|.|
plant   237 LLAIRAVYIPGSKFLPTKFNRRLRETERDM-------RAMFKAMIETKEEEIKR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 66/268 (25%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.