DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP735A1

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:547 Identity:143/547 - (26%)
Similarity:219/547 - (40%) Gaps:136/547 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSIFVAFIGLLLYKW-SVYTF------GYFSKRGVAHEKPIPLLGNIPWSVLMGKESYIKHSIDL 63
            |.|||..|..:||.. |.|..      ....::||...||.||.|||.....|..:|..|....:
plant    10 LVIFVTTILRVLYDTISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVSQSASKDCDSI 74

  Fly    64 HL----RLKQH-----KVYG----VFNLRDPLYYLSDPELIR----------------QVGIKNF 99
            |.    ||..|     |.||    |:|..||...|::.|||:                |.|.|||
plant    75 HHDIVGRLLPHYVAWSKQYGKRFIVWNGTDPRLCLTETELIKELLMKHNGVSGRSWLQQQGTKNF 139

  Fly   100 DTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRSTLTPTFTSLKI----RQMFELIHFCNVE 160
                               |.:.||....:.|...|....|.||..::    |.|.|    |..:
plant   140 -------------------IGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVE----CTSK 181

  Fly   161 AVDFVQRQLDAGTSELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGL 225
            .|:.:::::..|.:|:|:.:...:.|.|:|:...||......|:..|....:.:|.::.|     
plant   182 LVERLRKEVGEGANEVEIGEEMHKLTADIISRTKFGSSFEKGKELFNHLTVLQRRCAQAT----- 241

  Fly   226 KVMLYILMPKLMKALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQE 290
               .::..|...                    |...||.:|...::.::..||:|..:       
plant   242 ---RHLCFPGSR--------------------FLPSKYNREIKSLKKEVERLLIEIIQ------- 276

  Fly   291 GSAESAAQQDKAEFNDDDLLA------------------------QCLLFFSAGFETVATCLSFT 331
             |....|:..::..:.||||.                        :|..||.||.||.|..|::|
plant   277 -SRRDCAEMGRSSTHGDDLLGLLLNEMDIDKNNNNNNNNLQLIMDECKTFFFAGHETTALLLTWT 340

  Fly   332 SYELMMNPEVQEKLLAEILAVKEQLGEKPL-DYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGS 395
            :..|..||..|||:..|   |:|..|...| ..|.|..:..|:.|::||||.:|||.::.||...
plant   341 TMLLADNPTWQEKVREE---VREVFGRNGLPSVDQLSKLTSLSKVINESLRLYPPATLLPRMAFE 402

  Fly   396 DFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNF-PEPEQFRPERFDEEHKHEIRQFTYLPFGV 459
            |.:|.|      :.:.:...:.|.|.|:||..:.: .:..||.||||........|.|  :||..
plant   403 DLKLGD------LTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERFGGRPFASGRHF--IPFAA 459

  Fly   460 GQRSCIGNRLALMEVKSLIFQLVLRYH 486
            |.|:|||.:.||||.|.::..|:.:::
plant   460 GPRNCIGQQFALMEAKIILATLISKFN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 132/509 (26%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 143/547 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.