DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP709B3

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:529 Identity:128/529 - (24%)
Similarity:225/529 - (42%) Gaps:108/529 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FSKRGVAHEKPIPLLGNIPWSVLMGKESYI----KHSIDLHLRL--KQHK---VYG----VFNLR 79
            |.|:|::..|...|.||:.....|.||:.:    .:|.|:..|:  :.|:   .||    .:...
plant    40 FKKQGISGPKYKILYGNLSEIKKMKKEADLCVLDPNSNDIFPRVFPQYHQWMSQYGDTFLFWTGT 104

  Fly    80 DPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSV--------ISKSLLSLRDRRWKQMRS 136
            .|..|:|:.||.:||....|            ||....|        ..|.|..::...|.:.|.
plant   105 KPTIYISNHELAKQVLSSKF------------GFTIIPVKRPEVFILFGKGLSFIQGDDWIRHRR 157

  Fly   137 TLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAG--TSELELKDFFTRYTNDVIATAAF---- 195
            .|.|.|:..:::.|.:.:..|.:...:..::|...|  ..::|:...|.:.|.|:|||.||    
plant   158 ILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQRRNGEVLIKIEISKEFHKLTADIIATTAFGSSY 222

  Fly   196 --GIQVNSFKDPNNEFFSIGQRISEFT--FWGGLKVMLYILMPKLMKALRVPVMDMNNVDYFKKL 256
              ||::...:....:::     ||..|  |..|.:   |:..|..:|...:.....|::   |::
plant   223 AEGIELCRSQTELEKYY-----ISSLTNVFIPGTQ---YLPTPTNLKLWELHKKVKNSI---KRI 276

  Fly   257 VFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGF 321
            :...:|.:.:......|::.:::.|.:..:.|:             :...|:::.:|..|:.||.
plant   277 IDSRLKSKCKTYGYGDDLLGVMLTAAKSNEYER-------------KMRMDEIIEECKNFYYAGQ 328

  Fly   322 ETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLG-EKPLDYDTLMGMKYLNCVVSESLRKWPP 385
            .|.:..|::|:..|.::...||||..|:.   .:.| :|..|.||...:|.:|.|:.||||.:.|
plant   329 GTTSILLTWTTMLLSLHQGWQEKLREEVF---NECGKDKIPDTDTFSKLKLMNMVLMESLRLYGP 390

  Fly   386 AFIVDRMCGSDFQ---LKDEEGEVVVNLREDDLVHINVGALHHDPDNFPE-PEQFRPERFDEEHK 446
            ...:.|....|.:   |:..:|..::         |.:..:|.|...:.| .|||.|.||:    
plant   391 VIKISREATQDMKVGHLEIPKGTSII---------IPLLKMHRDKAIWGEDAEQFNPLRFE---- 442

  Fly   447 HEIRQFT-----YLPFGVGQRSCIGNRLALMEVKSLI------FQLVLRYHLKPTDRTPADMMSS 500
            :.|.|.|     .|||.:|.|:||....|::|.|:::      |||.|....|   .||.|    
plant   443 NGISQATIHPNALLPFSIGPRACIAKNFAMVEAKTVLTMILQQFQLSLSPEYK---HTPVD---- 500

  Fly   501 ISGFRLLPR 509
              .|.|.|:
plant   501 --HFDLFPQ 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 125/520 (24%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 128/529 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.