DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP72A11

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_188083.1 Gene:CYP72A11 / 820693 AraportID:AT3G14650 Length:512 Species:Arabidopsis thaliana


Alignment Length:495 Identity:123/495 - (24%)
Similarity:201/495 - (40%) Gaps:98/495 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FSKRGVAHEKPIPLLGNI-----PWSVLMGKESYIKHSIDLHLRLKQH-KVYGVFNLRDPLYYLS 86
            ||.|..|..|||.|..:|     |:.:.|               ||.| :.:..:....|...:.
plant    60 FSMRAEARSKPINLTDDITPRIVPYPLQM---------------LKTHGRTFFTWFGAIPTITIM 109

  Fly    87 DPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMF 151
            |||.|.:|..|.:|....|.      |....:|:..:||....:|.:.|..:.|.|...||:.|.
plant   110 DPEQITEVLNKVYDFQKAHT------FPLGRLIATGVLSYDGDKWAKHRRIINPAFHLEKIKNMV 168

  Fly   152 ELIH-FCNVEAVDFVQRQLDAGTS-ELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQ 214
            ...| .|:.....:.:...|..:| |:::.......|.|||:..|||.....           ||
plant   169 PAFHQSCSEIVCKWDKLVSDKESSCEVDVWPGLVSMTADVISRTAFGSSCVE-----------GQ 222

  Fly   215 RISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVDYFKKLVFGAMKYR-KEQSIVRPDMIHLL 278
            ||.|      |:..|..|:.:.::...:|     ...|........||.: :|..::...:::  
plant   223 RIFE------LQAELAQLIIQTVRKAFIP-----GYSYLPTKGNRRMKAKAREIQVILRGIVN-- 274

  Fly   279 MEAQRQFKAEQEGSA----------ESAAQQDKAE-FNDDDLLAQCLLFFSAGFETVATCLSFTS 332
                ::.:|.:.|.|          ||...|.|.. .:.:||:.:|.||:..|.||.:..|.:|.
plant   275 ----KRLRAREAGEAPNDDLLGILLESNLGQTKGNGMSTEDLMEECKLFYFVGQETTSVLLVWTM 335

  Fly   333 YELMMNPEVQEKLLAEILAVKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDF 397
            ..|..:.:.|.:...|   ||:..|:|..|.:.|..:|.:..::.|.||.:||...:.|....:.
plant   336 VLLSQHQDWQARAREE---VKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPIPQLSRAIHKEM 397

  Fly   398 QLKD--EEGEVVVNL------REDDLVHINVGALHHDPDNFPEPEQFRPERF-DEEHKHEIRQFT 453
            :|.|  ..|.|::||      |:.:|...:.|             :|:|:|| |...|....|.:
plant   398 ELGDLTLPGGVLINLPILLVQRDTELWGNDAG-------------EFKPDRFKDGLSKATKNQAS 449

  Fly   454 YLPFGVGQRSCIGNRLALMEVKSLIFQLVLR---YHLKPT 490
            :.||..|.|.|||...||:|.| :...|:|:   :.|.|:
plant   450 FFPFAWGSRICIGQNFALLEAK-MAMALILQRFSFELSPS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 119/486 (24%)
CYP72A11NP_188083.1 p450 24..512 CDD:299894 123/495 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.