DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP72A8

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 / 820690 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana


Alignment Length:517 Identity:121/517 - (23%)
Similarity:213/517 - (41%) Gaps:120/517 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YFSKRGVAHEKPIPLLGNIPWSVLMGKESYIKHSIDLHLRLKQHKVYGVFNLRDPLYYLSDPELI 91
            |..::|         |...|::.|:|.   ||....:   ::|.|...: ||.|...:...| ||
plant    42 YLKRQG---------LSGTPFTFLVGD---IKREASM---VEQEKSRPI-NLTDDYTHRVMP-LI 89

  Fly    92 RQVGIKNFD---------------TFTNHRKGITEGFND---------TSVISKSLLSLRDRRWK 132
            :|. :|:..               |...|.|.:.....|         ..:.:..:......:|.
plant    90 QQT-VKDHGKTSYMWMGPIASVIVTKPEHIKDVLNRVYDFPKPPVHPIVELFATGVALYEGEKWS 153

  Fly   133 QMRSTLTPTFTSLKIRQMFELIH-FCNVEAVDFVQRQLDAGTS-ELELKDFFTRYTNDVIATAAF 195
            :.|..:.|:|...|::.|....: .|:.....:.:...:.|:| |:::..:....|:|||:..||
plant   154 KHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNEIDVWPYLGDLTSDVISRTAF 218

  Fly   196 GIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVM----DMNNVDYFKKL 256
            |   :|:::        |:||.|.....|.:|:      |.::...:|.|    ..||       
plant   219 G---SSYEE--------GKRIFELQEEQGRRVL------KALELAFIPGMRFLPTKNN------- 259

  Fly   257 VFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFND--------------- 306
                ::.|:....|:..:..::|:.||            .....:|..||               
plant   260 ----LRMRQINKEVKSRLREIIMKRQR------------GMDTGEAPKNDLLGILLESNSGDHGM 308

  Fly   307 --DDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGE--KPLDYDTLM 367
              :|::.:|.||..||.||.|..|.:|...|..:.:.|::...|||.|   :|:  || ::|.|.
plant   309 SIEDVVEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKV---IGKNNKP-NFDALS 369

  Fly   368 GMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPE 432
            .:|.::.:::|.||.:||..::.|....:.:|.::     :.|.....|.|.|..:|.||:.:.|
plant   370 RLKTMSMILNEVLRLYPPGILLGRTVEKETKLGED-----MTLPGGAQVVIPVLMVHRDPELWGE 429

  Fly   433 P-EQFRPERF-DEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLR--YHLKPT 490
            . .:|.|||| |...|....|.::||||.|.|.|.|...||||.|..:..::.|  :.|.|:
plant   430 DVHEFNPERFADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSFELSPS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 119/507 (23%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 121/517 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.