DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and CYP709B2

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:513 Identity:120/513 - (23%)
Similarity:221/513 - (43%) Gaps:92/513 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FSKRGVAHEKPIPLLGNIPWSVLMGKESYI----KHSIDLHLRLKQH-----KVYGVFNL----R 79
            |.|:|::..|...|.||:.....|..|:.:    .:|.|:..|:..|     ..||...|    .
plant    95 FKKQGISGPKYRILYGNLREIRKMKNEAKLMVLDPNSNDIVPRVLPHLQQWKSQYGETFLYWQGT 159

  Fly    80 DPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKS---LLSLRDRRWKQMRSTLTPT 141
            ||...:||.||.:|:....|..|:..:       ....::..|   |:.:....|.:.|..|.|.
plant   160 DPRLCISDHELAKQILSNKFVFFSKSK-------TKPEILKLSGNGLIFVNGLDWVRHRRILNPA 217

  Fly   142 FTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELE----LKDFFTRYTNDVIATAAFGIQVNSF 202
            |:..|::.|.:|:..|....  |::.:......|.|    :...|.|.|.|:|||||||   :|:
plant   218 FSMDKLKLMTQLMVDCTFRM--FLEWKKQRNGVETEQFVLISREFKRLTADIIATAAFG---SSY 277

  Fly   203 KDPNNEFFS-------IGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVDYFKKLVFGA 260
            .:....|.|       ....:::..|.|    :.|:..|   ..|::..:||......|:::  .
plant   278 AEGIEVFKSQLELQKCCAAALTDLYFPG----IQYLPTP---SNLQIWKLDMKVNSSIKRII--D 333

  Fly   261 MKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGFETVA 325
            .:...|......|::.:::.|             :::.:.:.:.:.|:::.:|..||.||.||.|
plant   334 ARLTSESKDYGNDLLGIMLTA-------------ASSNESEKKMSIDEIIEECKTFFFAGHETTA 385

  Fly   326 TCLSFTSYELMMNPEVQEKLLAEILAVKEQLG-EKPLDYDTLMGMKYLNCVVSESLRKWPPAFIV 389
            ..|::::..|.::.:.||||..|:.   .:.| :|..|.:|...:|.:|.|..||||.:.|...:
plant   386 NLLTWSTMLLSLHQDWQEKLREEVF---NECGKDKIPDAETCSKLKLMNTVFMESLRLYGPVLNL 447

  Fly   390 DRMCGSDFQLKDEE---GEVVVNLREDDLVHINVGALHHDPDNF-PEPEQFRPERFDE------E 444
            .|:...|.:|.:.|   |..::         :.:..:|.|...: .:.::|.|.||..      .
plant   448 LRLASEDMKLGNLEIPKGTTII---------LPIAKMHRDKAVWGSDADKFNPMRFANGLSRAAN 503

  Fly   445 HKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPT---DRTPADMMS 499
            |.:.:     |.|.:|.|:|||...|:||.|:::..::.|:.|..:   ...|||.::
plant   504 HPNAL-----LAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLNLSADYKHAPADHLT 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 117/504 (23%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 120/513 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.