DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:432 Identity:104/432 - (24%)
Similarity:180/432 - (41%) Gaps:88/432 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNV---------EAVDFV----QRQLDAGTS 174
            |:|..| :|.:.|..|||.|            || |:         ::.:.:    ||....|::
Mouse   137 LMSTGD-KWSRHRRMLTPAF------------HF-NILKPYVKVFNDSTNIMHAKWQRLASKGSA 187

  Fly   175 ELELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKA 239
            .|.:.:..:..|.|.:....|....|..:.|:....:|              :.|..|:.:..:.
Mouse   188 YLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAI--------------LELSTLVARRHQR 238

  Fly   240 LRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEG----SAESAA--- 297
            |      :.:||.|..|....|::||...:|. |....::..:|:...:|.|    .|::.|   
Mouse   239 L------LLHVDLFYYLTHDGMRFRKACRLVH-DFTDAVIRERRRTLLDQGGVDVLKAKAKAKTL 296

  Fly   298 -----------QQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILA 351
                       :..|| .:|:|:.|:...|...|.:|.|:.||:..|.|..:||.||:...|:..
Mouse   297 DFIDVLLLSKDEHGKA-LSDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRE 360

  Fly   352 VKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLV 416
            :......:.:::|.|..:.:|...:.||||..||...:.|.|..|..|.|  |.|:   .:..:.
Mouse   361 LLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPD--GRVI---PKGVIS 420

  Fly   417 HINVGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQL 481
            .|::...||:|..:|:||.:.|.|||.::........::||..|.|:|||...|:.|:|..:...
Mouse   421 RISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALT 485

  Fly   482 VLRYHLKPTDRTPADMMSSISGFRLLPREL------FWCKLE 517
            :||:.:.|.|:.|          |..|..:      .|.|:|
Mouse   486 LLRFRVLPDDKEP----------RRKPELILRAEGGLWLKVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 101/427 (24%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 102/429 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.