DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4f16

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001343232.1 Gene:Cyp4f16 / 70101 MGIID:1917351 Length:524 Species:Mus musculus


Alignment Length:459 Identity:110/459 - (23%)
Similarity:191/459 - (41%) Gaps:72/459 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DLHLRLKQHKVYGVFNLRDPLY---YLSDPELIRQVGIKNFDTFTNHRK-GITEGFNDTSVISKS 122
            |:|| .....|..|..:.||.:   .|..|.|:....:    ||....| .:.:|.         
Mouse    86 DVHL-FWLGPVIPVLRIVDPAFVAPLLQAPALVAPKDM----TFLRFLKPWLGDGL--------- 136

  Fly   123 LLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDA-GTSELELKDFFTRYT 186
            .||..| :|.:.|..|||.| ...|.:.:..|...:|..:....:.|.: |::.||:.:..:..|
Mouse   137 FLSSGD-KWSRHRRLLTPAF-HFDILKPYVKIFNQSVNIMHAKWKHLSSEGSARLEMFEHISLMT 199

  Fly   187 NDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVD 251
            .|.:....||...|..:.| :|:.|....:|.......|::.|:                   ||
Mouse   200 LDSLQKCLFGFDSNCQESP-SEYISAILELSSLIIKRSLQLFLF-------------------VD 244

  Fly   252 YFKKLVFGAMKYRKEQSIVRPDMIHLLMEA---QRQFKAEQEGSAESAAQQDKA----------- 302
            :.........::||     ..|::|...:|   :|:.....:...|....:.|:           
Mouse   245 FLYYHTADGRRFRK-----ACDLVHNFTDAVIRERRHTLSSQNHDEFLKSKTKSKTLDFIDVLLL 304

  Fly   303 -------EFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKP 360
                   |.:|:|:.|:...|...|.:|.|:.||:..|.|..:||.||:...|:..:......:.
Mouse   305 AKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVQELLRDREPEE 369

  Fly   361 LDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHH 425
            :::|.|..:.:|...:.||||...|...:.|.|..|..|.|  |.|:   .:.::..|::..:||
Mouse   370 IEWDDLAQLPFLTMCIKESLRLHSPVIDLLRRCTRDIVLPD--GRVI---PKGNICVISIFGIHH 429

  Fly   426 DPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPT 490
            :|..:|:||.:.|.|||.|:..:.....::||..|.|:|||...|:.|:|..:...:||:.:.|.
Mouse   430 NPSVWPDPEVYDPFRFDPENPQKRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRILPD 494

  Fly   491 DRTP 494
            |:.|
Mouse   495 DKEP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 110/459 (24%)
Cyp4f16NP_001343232.1 p450 52..514 CDD:306555 110/459 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.