DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4a31

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_964002.2 Gene:Cyp4a31 / 666168 MGIID:3028580 Length:509 Species:Mus musculus


Alignment Length:446 Identity:104/446 - (23%)
Similarity:167/446 - (37%) Gaps:134/446 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLD-----AG-TSELE 177
            |...||.|..:.|.|.|..|||.|       .::::........|.::..||     || .|.:|
Mouse   126 IGYGLLLLNGQSWFQHRKMLTPAF-------HYDILKTYVKNMADSIRLMLDKWERLAGQDSSIE 183

  Fly   178 LKDFFTRYTNDVIATAAF----GIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMK 238
            :....:..|.|.:...||    .:||:                      |..|..|.        
Mouse   184 IFQHISLMTLDTVMKCAFSHKGSVQVD----------------------GNYKTYLQ-------- 218

  Fly   239 ALRVPVMDMNNV------------DYFKKL-----------------VFGAMKYRKEQSIVRPDM 274
                .:.|:||:            |...||                 ..|.:|.||:|       
Mouse   219 ----AIGDLNNLVHSRVRNMFHQNDTIYKLSSNGRLSNQACQLAHDHTDGVIKMRKDQ------- 272

  Fly   275 IHLLMEAQRQFKAEQEGSAESAAQQDKAEF---------------NDDDLLAQCLLFFSAGFETV 324
                        .:.||..|:..::.:.:|               :|.||.|:...|...|.:|.
Mouse   273 ------------LQDEGELENIKKKRRLDFLDILLFARMENEDSMSDKDLRAEVDTFMIEGHDTT 325

  Fly   325 ATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFI 388
            |:.:|:..|.|..:||.|::...|   |:..||: ..:.:|.|..:.|....:.|:||.:||...
Mouse   326 ASGVSWIFYALATHPEHQQRCREE---VQSLLGDGSSITWDHLDQIPYTTMCIKEALRLYPPVPS 387

  Fly   389 VDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERF---DEEHKHEIR 450
            :.|...:.....|.     .:|.:...|.:::..|||:|..:|.||.|.|.||   ...|.|   
Mouse   388 IGRELSTSVTFPDG-----CSLPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSPRHSH--- 444

  Fly   451 QFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTDRTPADMMSSISGFRL 506
              ::|||..|.|:|||.:.|:.|:|.::...:||:.|.|   .|..:..|::.|.|
Mouse   445 --SFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLP---DPTRVPMSLARFVL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 104/446 (23%)
Cyp4a31NP_964002.2 p450 52..503 CDD:278495 104/446 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.