DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9c1 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:566 Identity:129/566 - (22%)
Similarity:236/566 - (41%) Gaps:114/566 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFVAFIGLLLYKWSVYT------FGYFSKRGVAHEKPIPLLGNIPWSVLMGKESYIKHSIDLHLR 66
            |.|..:|.:|....||.      ..|..|  :.....:|.|||       ..|..:.|....:..
  Fly    29 ITVFLLGSILIFLVVYNKRRSRLVKYIEK--IPGPAAMPFLGN-------AIEMNVDHDELFNRV 84

  Fly    67 LKQHKVYG-------VFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSV---ISK 121
            :...|::|       |:....|...|.:||.:..:        .|.:|.:.:..:...:   :.:
  Fly    85 IGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPI--------LNSQKFVNKSHDYDYLHPWLGE 141

  Fly   122 SLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQR-QLDAGTSELELKDFFTRY 185
            .||:..||:|...|..|||.| ..||  :.:.|...|.::....:: .::.|:....|..:.|..
  Fly   142 GLLTSTDRKWHSRRKILTPAF-HFKI--LDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLC 203

  Fly   186 TNDVIATAAFGIQVNSFKDPNNEF----FSIGQRI----------SEFTFWGGLKVMLYILMPKL 236
            |.|::...|.|.::.:..:..:|:    :.||..:          |:|.|             .|
  Fly   204 TLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIF-------------SL 255

  Fly   237 MKALRVPVMDMNNVDYFKKLVFGAMKYRK-EQSIVR----------PD------------MIHLL 278
            ....::....:|.:..|..:|   ::.|| |.:|::          ||            .:.||
  Fly   256 TAEYKLHQSYINTLHGFSNMV---IRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLL 317

  Fly   279 MEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQE 343
            ::|.:      ||:.          .:::|:..:...|...|.:|.:..:|:|.:.|..:||.||
  Fly   318 IDASK------EGTV----------LSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQE 366

  Fly   344 KLLAEILAVKEQLGEKPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVV 408
            :::.|:.::.....|.|.....||.|:||.|.:.:|||.:|...::.||.|.|..:    |..:|
  Fly   367 RVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI----GGKIV 427

  Fly   409 NLREDDLVHINVGALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALME 473
            ......:  |...|||.:|..||:||||.|:.|..|:......|.|:||..|.|:|||.:.|::|
  Fly   428 PAGTQAI--IMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILE 490

  Fly   474 VKSLIFQLVLRYHLKPTDRTPADMMSSISGFRLLPRELFWCKLESR 519
            .|::|..::.:|.::..||  .:.::.:....|.|::....|:..|
  Fly   491 EKAVISTVLRKYKIEAVDR--REDLTLLGELILRPKDGLRVKITPR 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 119/524 (23%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 119/529 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.